Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CYP11B1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | CYP11B1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP168882
|
Novus Biologicals
NBP168882 |
100 μL |
Each of 1 for $436.00
|
|
Description
CYP11B1 Polyclonal specifically detects CYP11B1 in Human samples. It is validated for Western Blot.Specifications
CYP11B1 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
P15538 | |
1584 | |
Synthetic peptides corresponding to CYP11B1 (cytochrome P450, family 11, subfamily B, polypeptide 1) The peptide sequence was selected from the middle region of CYP11B1. Peptide sequence LALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPK. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
CPN1, CYPXIB1, cytochrome P450 11B1, mitochondrial, cytochrome p450 XIB1, cytochrome P450, family 11, subfamily B, polypeptide 1, cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 1, Cytochrome P-450c11, Cytochrome P450C11, EC 1.14.15, EC 1.14.15.4, FHICYP11B, FLJ36771, P450C11DKFZp686B05283, S11BH, Steroid 11-beta-hydroxylase, steroid 11-beta-monooxygenase | |
CYP11B1 | |
IgG | |
Affinity Purified | |
55 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title