Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CYP11B1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen CYP11B1
Immunogen Synthetic peptides corresponding to CYP11B1 (cytochrome P450, family 11, subfamily B, polypeptide 1) The peptide sequence was selected from the middle region of CYP11B1. Peptide sequence LALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPK.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16888220 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16888220UL
20ul Each for $149.00
Add to cart
 
NBP168882 View Documents Novus BiologicalsSupplier Diversity Partner
NBP168882
100 ul Each for $329.00
Add to cart
 
Description

Description

CYP11B1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

CYP11B1
Rabbit
Polyclonal
Unconjugated
1584
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to CYP11B1 (cytochrome P450, family 11, subfamily B, polypeptide 1) The peptide sequence was selected from the middle region of CYP11B1. Peptide sequence LALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPK.
Primary
IgG
CPN1, CYPXIB1, cytochrome P450 11B1, mitochondrial, cytochrome p450 XIB1, cytochrome P450, family 11, subfamily B, polypeptide 1, cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 1, Cytochrome P-450c11, Cytochrome P450C11, EC 1.14.15, EC 1.14.15.4, FHICYP11B, FLJ36771, P450C11DKFZp686B05283, S11BH, Steroid 11-beta-hydroxylase, steroid 11-beta-monooxygenase
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit