Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CYP2A13 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen CYP2A13
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP162400
View Documents
Novus Biologicals
NBP162400
100 μL
Each of 1 for $436.00
N/A
Description

Description

CYP2A13 Polyclonal specifically detects CYP2A13 in Human samples. It is validated for Western Blot.
Specifications

Specifications

CYP2A13
Polyclonal
Purified
RUO
Q16696
1553
Synthetic peptides corresponding to CYP2A13(cytochrome P450, family 2, subfamily A, polypeptide 13) The peptide sequence was selected from the C terminal of CYP2A13. Peptide sequence DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
CPAD, CYP2A, CYPIIA13, cytochrome P450 2A13, cytochrome P450, family 2, subfamily A, polypeptide 13, cytochrome P450, subfamily IIA (phenobarbital-inducible), polypeptide 13, EC 1.14.14.1
CYP2A13
IgG
Protein A purified
54 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit