Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CYP2A13 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
| Antigen | CYP2A13 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP162400
|
Novus Biologicals
NBP162400 |
100 μL |
Each of 1 for $436.00
|
N/A | |||||
Description
CYP2A13 Polyclonal specifically detects CYP2A13 in Human samples. It is validated for Western Blot.Specifications
| CYP2A13 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q16696 | |
| 1553 | |
| Synthetic peptides corresponding to CYP2A13(cytochrome P450, family 2, subfamily A, polypeptide 13) The peptide sequence was selected from the C terminal of CYP2A13. Peptide sequence DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CPAD, CYP2A, CYPIIA13, cytochrome P450 2A13, cytochrome P450, family 2, subfamily A, polypeptide 13, cytochrome P450, subfamily IIA (phenobarbital-inducible), polypeptide 13, EC 1.14.14.1 | |
| CYP2A13 | |
| IgG | |
| Protein A purified | |
| 54 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title