Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CYP4A22 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CYP4A22 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180496
|
Novus Biologicals
NBP180496 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
CYP4A22 Polyclonal specifically detects CYP4A22 in Human samples. It is validated for Western Blot.Specifications
| CYP4A22 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CYPIVA22, cytochrome P450 4A22K, cytochrome P450, family 4, subfamily A, polypeptide 22 | |
| CYP4A22 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001010969 | |
| 284541 | |
| Synthetic peptide directed towards the N terminal of human CYP4A22. Peptide sequence AQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRIQERVKTFPS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title