CYP4X1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162382

Catalog No. NBP162382

Description

CYP4X1 Polyclonal specifically detects CYP4X1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CYP4X1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CYPIVX1, cytochrome P450 4X1, cytochrome P450, family 4, subfamily X, polypeptide 1, EC 1.14.14.1, MGC40051
• Host Species: Rabbit
• Molecular Weight of Antigen: 59 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N118
• Gene Symbols: CYP4X1
• Immunogen: Synthetic peptides corresponding to CYP4X1(cytochrome P450, family 4, subfamily X, polypeptide 1) The peptide sequence was selected from the middle region of CYP4X1. Peptide sequence LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 260293
• Target Species: Human
• Isotype: IgG