Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CYP4X1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CYP4X1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP162382
|
Novus Biologicals
NBP162382 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
CYP4X1 Polyclonal specifically detects CYP4X1 in Human samples. It is validated for Western Blot.Specifications
| CYP4X1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8N118 | |
| 260293 | |
| Synthetic peptides corresponding to CYP4X1(cytochrome P450, family 4, subfamily X, polypeptide 1) The peptide sequence was selected from the middle region of CYP4X1. Peptide sequence LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CYPIVX1, cytochrome P450 4X1, cytochrome P450, family 4, subfamily X, polypeptide 1, EC 1.14.14.1, MGC40051 | |
| CYP4X1 | |
| IgG | |
| Affinity Purified | |
| 59 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title