Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CYP51A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179790

 View more versions of this product

Catalog No. NBP179790

Add to cart



CYP51A1 Polyclonal antibody specifically detects CYP51A1 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptide directed towards the N terminal of human CYP51A1The immunogen for this antibody is CYP51A1. Peptide sequence TYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQ.
57 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
CP51, CYP51Cytochrome P450LI, CYPL1, CYPLI, Cytochrome P450 51A1, cytochrome P450, family 51, subfamily A, polypeptide 1, Cytochrome P450-14DM, EC, lanosterol 14-alpha demethylase, lanosterol 14-alpha-demethylase, LDMCytochrome P45014DM, P450-14DM, P450L1,51 (lanosterol 14-alpha-demethylase), Sterol 14-alpha demethylase
Immunogen affinity purified
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit