Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CYP51A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | CYP51A1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179790
|
Novus Biologicals
NBP179790 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
CYP51A1 Polyclonal specifically detects CYP51A1 in Human samples. It is validated for Western Blot.Specifications
| CYP51A1 | |
| Polyclonal | |
| Rabbit | |
| NP_000777 | |
| 1595 | |
| Synthetic peptide directed towards the N terminal of human CYP51A1The immunogen for this antibody is CYP51A1. Peptide sequence TYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CP51, CYP51Cytochrome P450LI, CYPL1, CYPLI, Cytochrome P450 51A1, cytochrome P450, family 51, subfamily A, polypeptide 1, Cytochrome P450-14DM, EC 1.14.13.70, lanosterol 14-alpha demethylase, lanosterol 14-alpha-demethylase, LDMCytochrome P45014DM, P450-14DM, P450L1,51 (lanosterol 14-alpha-demethylase), Sterol 14-alpha demethylase | |
| CYP51A1 | |
| IgG | |
| 57 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title