CYP8B1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168884

Catalog No. NBP168884

Description

CYP8B1 Polyclonal specifically detects CYP8B1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CYP8B1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CP8B, CYP127 alpha-hydroxy-4-cholesten-3-one 12-alpha-hydroxylase, CYPVIIIB1, Cytochrome P450 8B1, cytochrome P450, family 8, subfamily B, polypeptide 1, cytochrome P450, subfamily VIIIB (sterol 12-alpha-hydroxylase), polypeptide 1,7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase, EC 1.14.13.95, FLJ17826,7-alpha-hydroxy-4-cholesten-3-one 12-alpha-hydroxylase, Sterol 12-alpha-hydroxylase
• Host Species: Rabbit
• Molecular Weight of Antigen: 58 kDa
• Quantity: 100 μL
• Research Discipline: Cancer, Cardiovascular Biology, Cellular Signaling, metabolism
• Gene ID (Entrez): 1582
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UNU6
• Gene Symbols: CYP8B1
• Immunogen: Synthetic peptides corresponding to CYP8B1 (cytochrome P450, family 8, subfamily B, polypeptide 1) The peptide sequence was selected from the middle region of CYP8B1. Peptide sequence SLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.