Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cystatin E/M/CST6 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Cystatin E/M/CST6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP169005
|
Novus Biologicals
NBP169005 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Cystatin E/M/CST6 Polyclonal specifically detects Cystatin E/M/CST6 in Mouse samples. It is validated for Western Blot.Specifications
| Cystatin E/M/CST6 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| cystatin 6, cystatin E/M, cystatin M, cystatin M/E, Cystatin-6, Cystatin-E, cystatin-M, cysteine proteinase inhibitor | |
| CST6 | |
| IgG | |
| Affinity Purified | |
| 16 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9D1B1 | |
| 1474 | |
| Synthetic peptides corresponding to Cst6 (cystatin E/M) The peptide sequence was selected from the middle region of Cst6. Peptide sequence CGELIPPPPPSYRLSLTLTSPLSTAAKELVLIPLHAAPNQAVAEIDALYD. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title