Cytochrome P450 2C18 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157975

Catalog No. NBP157975

Description

Cytochrome P450 2C18 Polyclonal specifically detects Cytochrome P450 2C18 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Cytochrome P450 2C18
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P33260
• Gene Symbols: CYP2C18
• Immunogen: Synthetic peptides corresponding to CYP2C18(cytochrome P450, family 2, subfamily C, polypeptide 18) The peptide sequence was selected from the N terminal of CYP2C18. Peptide sequence MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM.
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 1562
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: (S)-mephenytoin hydroxylase associated cytochrome P450, CPCI, CYP2C, CYP2C17, CYPIIC18, cytochrome P450 2C18, cytochrome P450, family 2, subfamily C, polypeptide 18, cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 17, cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 18, Cytochrome P450-6b/29c, DKFZp686I24235, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase, P450-6B/29C, P450IIC17, unspecific monooxygenase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 78%; Sheep: 78%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Equine, Guinea Pig, Rabbit, Sheep
• Isotype: IgG