Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cytochrome P450 2C18 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Cytochrome P450 2C18 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157975
|
Novus Biologicals
NBP157975 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Cytochrome P450 2C18 Polyclonal specifically detects Cytochrome P450 2C18 in Human samples. It is validated for Western Blot.Specifications
| Cytochrome P450 2C18 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| (S)-mephenytoin hydroxylase associated cytochrome P450, CPCI, CYP2C, CYP2C17, CYPIIC18, cytochrome P450 2C18, cytochrome P450, family 2, subfamily C, polypeptide 18, cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 17, cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 18, Cytochrome P450-6b/29c, DKFZp686I24235, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase, P450-6B/29C, P450IIC17, unspecific monooxygenase | |
| CYP2C18 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P33260 | |
| 1562 | |
| Synthetic peptides corresponding to CYP2C18(cytochrome P450, family 2, subfamily C, polypeptide 18) The peptide sequence was selected from the N terminal of CYP2C18. Peptide sequence MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title