Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Cytochrome P450 2C18 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen Cytochrome P450 2C18
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157975
View Documents
Novus Biologicals
NBP157975
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

Cytochrome P450 2C18 Polyclonal specifically detects Cytochrome P450 2C18 in Human samples. It is validated for Western Blot.
Specifications

Specifications

Cytochrome P450 2C18
Polyclonal
Rabbit
Lipid and Metabolism
(S)-mephenytoin hydroxylase associated cytochrome P450, CPCI, CYP2C, CYP2C17, CYPIIC18, cytochrome P450 2C18, cytochrome P450, family 2, subfamily C, polypeptide 18, cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 17, cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 18, Cytochrome P450-6b/29c, DKFZp686I24235, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase, P450-6B/29C, P450IIC17, unspecific monooxygenase
CYP2C18
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
P33260
1562
Synthetic peptides corresponding to CYP2C18(cytochrome P450, family 2, subfamily C, polypeptide 18) The peptide sequence was selected from the N terminal of CYP2C18. Peptide sequence MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit