Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Cytochrome P450 3A5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen Cytochrome P450 3A5
Immunogen Synthetic peptides corresponding to CYP3A5 (cytochrome P450, family 3, subfamily A, polypeptide 5) The peptide sequence was selected from the N terminal of CYP3A5. Peptide sequence AITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSL.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16888520 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16888520UL
20ul Each for $149.00
Add to cart
 
NBP168885 View Documents Novus BiologicalsSupplier Diversity Partner
NBP168885
100 ul Each for $329.00
Add to cart
 
Description

Description

Cytochrome P450 3A5 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Western Blotting.
Specifications

Specifications

Cytochrome P450 3A5
Rabbit
Polyclonal
Unconjugated
1577
Affinity Purified
Western Blot, Immunohistochemistry
RUO
Synthetic peptides corresponding to CYP3A5 (cytochrome P450, family 3, subfamily A, polypeptide 5) The peptide sequence was selected from the N terminal of CYP3A5. Peptide sequence AITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSL.
Primary
IgG
aryl hydrocarbon hydroxylase, CP35, CYPIIIA5, cytochrome P-450, cytochrome P450 3A5, Cytochrome P450 HLp2, cytochrome P450, family 3, subfamily A, polypeptide 5, cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 5, Cytochrome P450-PCN3, DKFZp686L16231, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase, niphedipine oxidase, P450PCN3FLJ31317, PCN3, xenobiotic monooxygenase
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit