Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Cytochrome P450 3A5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen Cytochrome P450 3A5
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16888520
View Documents
Novus Biologicals
NBP16888520UL
20 μL
Each for $152.22
Add to cart
 
NBP168885
View Documents
Novus Biologicals
NBP168885
100 μL
Each for $436.00
Add to cart
 
Description

Description

Cytochrome P450 3A5 Polyclonal specifically detects Cytochrome P450 3A5 in Human samples. It is validated for Western Blot, Immunohistochemistry.
Specifications

Specifications

Cytochrome P450 3A5
Polyclonal
Rabbit
Lipid and Metabolism
P51589
1577
Synthetic peptides corresponding to CYP3A5 (cytochrome P450, family 3, subfamily A, polypeptide 5) The peptide sequence was selected from the N terminal of CYP3A5. Peptide sequence AITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSL.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
aryl hydrocarbon hydroxylase, CP35, CYPIIIA5, cytochrome P-450, cytochrome P450 3A5, Cytochrome P450 HLp2, cytochrome P450, family 3, subfamily A, polypeptide 5, cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 5, Cytochrome P450-PCN3, DKFZp686L16231, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase, niphedipine oxidase, P450PCN3FLJ31317, PCN3, xenobiotic monooxygenase
CYP3A5
IgG
Affinity Purified
57 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit