Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cytochrome P450 3A5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | Cytochrome P450 3A5 |
---|---|
Applications | Western Blot, Immunohistochemistry |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP16888520
|
Novus Biologicals
NBP16888520UL |
20 μL |
Each for $152.22
|
|
NBP168885
|
Novus Biologicals
NBP168885 |
100 μL |
Each for $436.00
|
|
Description
Cytochrome P450 3A5 Polyclonal specifically detects Cytochrome P450 3A5 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
Cytochrome P450 3A5 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
P51589 | |
1577 | |
Synthetic peptides corresponding to CYP3A5 (cytochrome P450, family 3, subfamily A, polypeptide 5) The peptide sequence was selected from the N terminal of CYP3A5. Peptide sequence AITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
aryl hydrocarbon hydroxylase, CP35, CYPIIIA5, cytochrome P-450, cytochrome P450 3A5, Cytochrome P450 HLp2, cytochrome P450, family 3, subfamily A, polypeptide 5, cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 5, Cytochrome P450-PCN3, DKFZp686L16231, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase, niphedipine oxidase, P450PCN3FLJ31317, PCN3, xenobiotic monooxygenase | |
CYP3A5 | |
IgG | |
Affinity Purified | |
57 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title