Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cytokeratin 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP169045
Description
Cytokeratin 3 Polyclonal specifically detects Cytokeratin 3 in Human samples. It is validated for Western Blot.Specifications
Cytokeratin 3 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
KRT3 | |
Synthetic peptides corresponding to KRT3 (keratin 3) The peptide sequence was selected from the C terminal of KRT3. Peptide sequence GSSGFSGGSGFGSISGARYGVSGGGFSSASNRGGSIKFSQSSQSSQRYSR. | |
Affinity purified | |
RUO | |
3850 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
CK3, CK-3, cytokeratin-3, FLJ95909, K3cytokeratin 3, keratin 3, keratin, type II cytoskeletal 3,65 kDa cytokeratin, Keratin-3, Type-II keratin Kb3 | |
Rabbit | |
64 kDa | |
100 μL | |
Primary | |
Rabbit: 79%. | |
Human, Rabbit | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction