Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP154403
Description
Cytosolic Sulfotransferase 1B1/SULT1B1 Polyclonal specifically detects Cytosolic Sulfotransferase 1B1/SULT1B1 in Human samples. It is validated for Western Blot.Specifications
Cytosolic Sulfotransferase 1B1/SULT1B1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
EC 2.8.2, EC 2.8.2.-, EC 2.8.2.1, EC 2.8.2.4, MGC13356, ST1B1, ST1B2sulfotransferase family cytosolic 1B member 1, Sulfotransferase 1B1, Sulfotransferase 1B2, sulfotransferase family, cytosolic, 1B, member 1, SULT1B2, Thyroid hormone sulfotransferase | |
Rabbit | |
35 kDa | |
100 μL | |
metabolism | |
27284 | |
Human, Porcine, Bovine, Canine | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
O43704 | |
SULT1B1 | |
Synthetic peptides corresponding to SULT1B1(sulfotransferase family, cytosolic, 1B, member 1) The peptide sequence was selected from the N terminal of SULT1B1. Peptide sequence KRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFW. | |
Affinity purified | |
RUO | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction