Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cytosolic Sulfotransferase 1B1/SULT1B1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Cytosolic Sulfotransferase 1B1/SULT1B1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154403
|
Novus Biologicals
NBP154403 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Cytosolic Sulfotransferase 1B1/SULT1B1 Polyclonal specifically detects Cytosolic Sulfotransferase 1B1/SULT1B1 in Human samples. It is validated for Western Blot.Specifications
| Cytosolic Sulfotransferase 1B1/SULT1B1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 2.8.2, EC 2.8.2.-, EC 2.8.2.1, EC 2.8.2.4, MGC13356, ST1B1, ST1B2sulfotransferase family cytosolic 1B member 1, Sulfotransferase 1B1, Sulfotransferase 1B2, sulfotransferase family, cytosolic, 1B, member 1, SULT1B2, Thyroid hormone sulfotransferase | |
| SULT1B1 | |
| IgG | |
| Affinity Purified | |
| 35 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O43704 | |
| 27284 | |
| Synthetic peptides corresponding to SULT1B1(sulfotransferase family, cytosolic, 1B, member 1) The peptide sequence was selected from the N terminal of SULT1B1. Peptide sequence KRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFW. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title