Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Cytosolic Sulfotransferase 1B1/SULT1B1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen Cytosolic Sulfotransferase 1B1/SULT1B1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP154403
View Documents
Novus Biologicals
NBP154403
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

Cytosolic Sulfotransferase 1B1/SULT1B1 Polyclonal specifically detects Cytosolic Sulfotransferase 1B1/SULT1B1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

Cytosolic Sulfotransferase 1B1/SULT1B1
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
EC 2.8.2, EC 2.8.2.-, EC 2.8.2.1, EC 2.8.2.4, MGC13356, ST1B1, ST1B2sulfotransferase family cytosolic 1B member 1, Sulfotransferase 1B1, Sulfotransferase 1B2, sulfotransferase family, cytosolic, 1B, member 1, SULT1B2, Thyroid hormone sulfotransferase
SULT1B1
IgG
Affinity Purified
35 kDa
Western Blot
Unconjugated
RUO
O43704
27284
Synthetic peptides corresponding to SULT1B1(sulfotransferase family, cytosolic, 1B, member 1) The peptide sequence was selected from the N terminal of SULT1B1. Peptide sequence KRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFW.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit