Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	Cytosolic Sulfotransferase 2B1/SULT2B1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP154830 missing translation for 'viewDocuments' missing translation for 'viewProductCertificates'	Novus Biologicals NBP154830	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Cytosolic Sulfotransferase 2B1/SULT2B1 Polyclonal specifically detects Cytosolic Sulfotransferase 2B1/SULT2B1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	Cytosolic Sulfotransferase 2B1/SULT2B1
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Alias	Alcohol sulfotransferase, EC 2.8.2, EC 2.8.2.2, HSST2sulfotransferase family cytosolic 2B member 1, Hydroxysteroid sulfotransferase 2, ST2B1, Sulfotransferase 2B1, sulfotransferase family, cytosolic, 2B, member 1
Gene Symbols	SULT2B1
Isotype	IgG
Molecular Weight of Antigen	39 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	O00204-2
Gene ID (Entrez)	6820
Immunogen	Synthetic peptides corresponding to SULT2B1(sulfotransferase family, cytosolic, 2B, member 1) The peptide sequence was selected from the N terminal of SULT2B1. Peptide sequence MASPPPFHSQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFI.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents