Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

D4S234E Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180544

 View more versions of this product

Catalog No. NBP180544


Add to cart

Description

Description

D4S234E Polyclonal antibody specifically detects D4S234E in Human, Mouse, Rat, Bovine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

D4S234E
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
NSG1
Synthetic peptide directed towards the N terminal of human D4S234E. Peptide sequence MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKT.
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Human: 100%.
Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat
Western Blot
Western Blot 1:1000
NP_001035190
carboxyterminally EE-tagged neuron-enriched endosomal 21 kDa protein, D4S234Brain neuron cytoplasmic protein 1, DNA segment on chromosome 4 (unique) 234 expressed sequence, NEEP21, neuron-specific protein family member 1, NSG1, P21
Rabbit
IgG
100 ul
Signal Transduction
Primary
27065
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit