Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

D4S234E Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $378.35

Specifications

Antigen D4S234E
Immunogen Synthetic peptide directed towards the N terminal of human D4S234E. Peptide sequence MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKT.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP18054420 View Documents Novus Biologicals
NBP18054420UL
20ul Each for $152.22
Add to cart
 
NBP180544 View Documents Novus Biologicals
NBP180544
100 ul Each for $378.35
Add to cart
 
Description

Description

D4S234E Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

D4S234E
Rabbit
Polyclonal
Unconjugated
27065
Affinity Purified
Western Blot
RUO
Synthetic peptide directed towards the N terminal of human D4S234E. Peptide sequence MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKT.
Primary
IgG
carboxyterminally EE-tagged neuron-enriched endosomal 21 kDa protein, D4S234Brain neuron cytoplasmic protein 1, DNA segment on chromosome 4 (unique) 234 expressed sequence, NEEP21, neuron-specific protein family member 1, NSG1, P21
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit