Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DACH2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | DACH2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180001
|
Novus Biologicals
NBP180001 |
100 μL |
Each for $436.00
|
|
NBP1800020
|
Novus Biologicals
NBP18000120UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
DACH2 Polyclonal specifically detects DACH2 in Human samples. It is validated for Western Blot.Specifications
| DACH2 | |
| Polyclonal | |
| Rabbit | |
| NP_444511 | |
| 117154 | |
| Synthetic peptide directed towards the C terminal of human DACH2. Peptide sequence TKRKLQEALEFESKRREQVEQALKQATTSDSGLRMLKDTGIPDIEIENNG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Dach2, dachshund homolog 2, dachshund homolog 2 (Drosophila), FLJ31391, MGC138545 | |
| DACH2 | |
| IgG | |
| Affinity Purified | |
| 65 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title