Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DAK Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen DAK
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP154881
View Documents
Novus Biologicals
NBP154881
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

DAK Polyclonal specifically detects DAK in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

DAK
Polyclonal
Rabbit
Lipid and Metabolism
Q3LXA3
26007
Synthetic peptides corresponding to DAK(dihydroxyacetone kinase 2 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of DAK. Peptide sequence MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVA.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
ATP-dependent dihydroxyacetone kinase, bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing), DHA kinase, Dha kinase/FMN cyclase, dihydroxyacetone kinase 2 homolog (S. cerevisiae), dihydroxyacetone kinase 2 homolog (yeast), DKFZp586B1621, FAD-AMP lyase cyclic FMN forming, FAD-AMP lyase cyclizing, glycerone kinase, MGC5621, NET45
DAK
IgG
Affinity Purified
59 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit