Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DAK Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | DAK |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154881
|
Novus Biologicals
NBP154881 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
DAK Polyclonal specifically detects DAK in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| DAK | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| Q3LXA3 | |
| 26007 | |
| Synthetic peptides corresponding to DAK(dihydroxyacetone kinase 2 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of DAK. Peptide sequence MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| ATP-dependent dihydroxyacetone kinase, bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing), DHA kinase, Dha kinase/FMN cyclase, dihydroxyacetone kinase 2 homolog (S. cerevisiae), dihydroxyacetone kinase 2 homolog (yeast), DKFZp586B1621, FAD-AMP lyase cyclic FMN forming, FAD-AMP lyase cyclizing, glycerone kinase, MGC5621, NET45 | |
| DAK | |
| IgG | |
| Affinity Purified | |
| 59 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title