Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DAP Kinase 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | DAP Kinase 1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1590020
|
Novus Biologicals
NBP15900120UL |
20 μL |
Each for $152.22
|
|
NBP159001
|
Novus Biologicals
NBP159001 |
100 μL |
Each for $436.00
|
|
Description
DAP Kinase 1 Polyclonal specifically detects DAP Kinase 1 in Human samples. It is validated for Western Blot.Specifications
| DAP Kinase 1 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer | |
| P53355 | |
| 1612 | |
| Synthetic peptides corresponding to DAPK1(death-associated protein kinase 1) The peptide sequence was selected from the N terminal of DAPK1. Peptide sequence MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DAPKDAP kinase 1, death-associated protein kinase 1, DKFZp781I035, EC 2.7.11, EC 2.7.11.1 | |
| DAPK1 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title