Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Daxx Mouse anti-Human, Clone: CL3580, Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus Biologicals NBP261622

Catalog No. NBP261622


Add to cart

Description

Description

Daxx Monoclonal antibody specifically detects Daxx in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

Daxx
CL3580
Immunohistochemistry 1:200 - 1:500
Purified
DAXX
This antibody was developed against a recombinant protein corresponding to amino acids: ARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTR
Protein A purified
Apoptosis, Cancer, Tumor Suppressors
Primary
1616
Human
Immunohistochemistry
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
BING2, CENP-C binding protein, DAP6MGC126245, Daxx, death domain-associated protein 6, death-associated protein 6, death-domain associated protein, EAP1, ETS1-associated protein 1, Fas death domain-associated protein, Fas-binding protein, hDaxx, MGC126246
Mouse
IgG1
100 ul
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Monoclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit