Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DAZAP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | DAZAP1 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP157255
|
Novus Biologicals
NBP157255 |
100 μL |
Each for $436.00
|
|
NBP15725520
|
Novus Biologicals
NBP15725520UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
DAZAP1 Polyclonal specifically detects DAZAP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
DAZAP1 | |
Polyclonal | |
Purified | |
RUO | |
Q96EP5 | |
26528 | |
Synthetic peptides corresponding to DAZAP1 (DAZ associated protein 1) The peptide sequence was selected from the C terminal of DAZAP1. Peptide sequence GFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DAZ associated protein 1, DAZ-associated protein 1, deleted in azoospermia associated protein 1, Deleted in azoospermia-associated protein 1, MGC19907 | |
DAZAP1 | |
IgG | |
Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title