Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DAZAP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen DAZAP1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157255
View Documents
Novus Biologicals
NBP157255
100 μL
Each for $436.00
Add to cart
 
NBP15725520
View Documents
Novus Biologicals
NBP15725520UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

DAZAP1 Polyclonal specifically detects DAZAP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

DAZAP1
Polyclonal
Purified
RUO
Q96EP5
26528
Synthetic peptides corresponding to DAZAP1 (DAZ associated protein 1) The peptide sequence was selected from the C terminal of DAZAP1. Peptide sequence GFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
DAZ associated protein 1, DAZ-associated protein 1, deleted in azoospermia associated protein 1, Deleted in azoospermia-associated protein 1, MGC19907
DAZAP1
IgG
Protein A purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit