Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DBX2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17921120UL
Description
DBX2 Polyclonal specifically detects DBX2 in Human samples. It is validated for Western Blot.Specifications
DBX2 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_001004329 | |
DBX2 | |
Synthetic peptide directed towards the middle region of human DBX2The immunogen for this antibody is DBX2. Peptide sequence SSPRWRENSPEPSERLIQESSGAPPPEANSLQGALYLCSEEEAGSKGVLT. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
developing brain homeobox 2, developing brain homeobox protein 2, FLJ16139, homeobox protein DBX2 | |
Rabbit | |
Affinity Purified | |
RUO | |
440097 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title