DC-SIGNR/CD299/CLEC4M Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP159181	Novus Biologicals NBP159181	100 μL

Description

DC-SIGNR/CD299/CLEC4M Polyclonal specifically detects DC-SIGNR/CD299/CLEC4M in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DC-SIGNR/CD299/CLEC4M
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Signal Transduction
• Gene Alias: CD209L1, CD209Ldendritic cell-specific ICAM-3-grabbing nonintegrin 2, CD299, CD299 antigenMGC129964, C-type lectin domain family 4, member M, DC-SIGN2CD209 antigen-like protein 1, DC-SIGNRDC-SIGN-related protein, DCSIGNRMGC47866, Dendritic cell-specific ICAM-3-grabbing non-integrin 2, HP10347, liver/lymph node-specific ICAM-3 grabbing non-integrin, Liver/lymph node-specific ICAM-3-grabbing non-integrin, L-SIGN, LSIGNC-type lectin domain family 4 member M, mannose binding C-type lectin DC-SIGNR
• Gene Symbols: CLEC4M
• Isotype: IgG
• Purification Method: Affinity Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Gene Accession No.: Q9H2X3
• Gene ID (Entrez): 10332
• Immunogen: Synthetic peptides corresponding to CLEC4M(C-type lectin domain family 4, member M) The peptide sequence was selected from the n terminal of CLEC4M. Peptide sequence MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGA.
• Primary or Secondary: Primary
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.