Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DC-SIGNR/CD299/CLEC4M Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen DC-SIGNR/CD299/CLEC4M
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP159181
View Documents
Novus Biologicals
NBP159181
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

DC-SIGNR/CD299/CLEC4M Polyclonal specifically detects DC-SIGNR/CD299/CLEC4M in Human samples. It is validated for Western Blot.
Specifications

Specifications

DC-SIGNR/CD299/CLEC4M
Polyclonal
Rabbit
Signal Transduction
CD209L1, CD209Ldendritic cell-specific ICAM-3-grabbing nonintegrin 2, CD299, CD299 antigenMGC129964, C-type lectin domain family 4, member M, DC-SIGN2CD209 antigen-like protein 1, DC-SIGNRDC-SIGN-related protein, DCSIGNRMGC47866, Dendritic cell-specific ICAM-3-grabbing non-integrin 2, HP10347, liver/lymph node-specific ICAM-3 grabbing non-integrin, Liver/lymph node-specific ICAM-3-grabbing non-integrin, L-SIGN, LSIGNC-type lectin domain family 4 member M, mannose binding C-type lectin DC-SIGNR
CLEC4M
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q9H2X3
10332
Synthetic peptides corresponding to CLEC4M(C-type lectin domain family 4, member M) The peptide sequence was selected from the n terminal of CLEC4M. Peptide sequence MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGA.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit