Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DCAF4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | DCAF4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15286220
|
Novus Biologicals
NBP15286220UL |
20 μL |
Each for $152.22
|
|
NBP152862
|
Novus Biologicals
NBP152862 |
100 μL |
Each for $436.00
|
|
Description
DCAF4 Polyclonal specifically detects DCAF4 in Human samples. It is validated for Western Blot.Specifications
| DCAF4 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DDB1 and CUL4 associated factor 4, DDB1- and CUL4-associated factor 4, DKFZp434K114, MGC20547, MGC46524, WD repeat domain 21, WD repeat domain 21A, WD repeat-containing protein 21A, WDR21, WDR21A | |
| DCAF4 | |
| IgG | |
| Affinity Purified | |
| 43 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8IV10 | |
| 26094 | |
| Synthetic peptides corresponding to WDR21A(WD repeat domain 21A) The peptide sequence was selected from the middle region of WDR21A. Peptide sequence GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title