Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DCAF4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00


Antigen DCAF4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
20 μL
Each for $152.22
Add to cart
View Documents
Novus Biologicals
100 μL
Each for $436.00
Add to cart


DCAF4 Polyclonal specifically detects DCAF4 in Human samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
DDB1 and CUL4 associated factor 4, DDB1- and CUL4-associated factor 4, DKFZp434K114, MGC20547, MGC46524, WD repeat domain 21, WD repeat domain 21A, WD repeat-containing protein 21A, WDR21, WDR21A
Affinity Purified
43 kDa
Western Blot
Synthetic peptides corresponding to WDR21A(WD repeat domain 21A) The peptide sequence was selected from the middle region of WDR21A. Peptide sequence GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT.
Store at -20C. Avoid freeze-thaw cycles.
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit