Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DCDC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | DCDC1 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB126315
|
Novus Biologicals
NBP310707100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
DCDC1 Polyclonal specifically detects DCDC1 in Human samples. It is validated for Western Blot.Specifications
DCDC1 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
Doublecortin Domain Containing 1, Doublecortin Domain-Containing Protein 1 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of human DCDC1. Peptide sequence KTTEPYAPVRLRVLQNGEKNKNRSVTILGPDISPGRKTQCTEILNLPSAA | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
341019 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title