Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DDI1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | DDI1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15681720
|
Novus Biologicals
NBP15681720UL |
20 μL |
Each for $152.22
|
|
NBP156817
|
Novus Biologicals
NBP156817 |
100 μL |
Each for $436.00
|
|
Description
DDI1 Polyclonal specifically detects DDI1 in Human samples. It is validated for Western Blot.Specifications
| DDI1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8WTU0 | |
| 414301 | |
| Synthetic peptides corresponding to DDI1(DDI1, DNA-damage inducible 1, homolog 1 (S. cerevisiae)) The peptide sequence was selected from the middle region of DDI1. Peptide sequence KNVLVIGTTGTQTYFLPEGELPLCSRMVSGQDESSDKEITHSVMDSGRKE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DDI1, DNA-damage inducible 1, homolog 1, DDI1, DNA-damage inducible 1, homolog 1 (S. cerevisiae), DNA-damage inducible 1 homolog 1 (S. cerevisiae), DNA-damage inducible protein 1, FLJ36017, protein DDI1 homolog 1 | |
| DDI1 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title