Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DDX25 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157341
Description
DDX25 Polyclonal specifically detects DDX25 in Human samples. It is validated for Western Blot.Specifications
DDX25 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DEAD (Asp-Glu-Ala-Asp) box polypeptide 25, DEAD box protein 25, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 25, EC 3.6.1, EC 3.6.4.13, Gonadotropin-regulated testicular RNA helicase, GRTHATP-dependent RNA helicase DDX25 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Xenopus: 85%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9UHL0-2 | |
DDX25 | |
Synthetic peptides corresponding to DDX25 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 25) The peptide sequence was selected from the C terminal of DDX25. Peptide sequence TVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDV. | |
100 μL | |
Stem Cell Markers | |
29118 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction