Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DDX25 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen DDX25
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1573420
View Documents
Novus Biologicals
NBP15734120UL
20 μL
Each for $152.22
Add to cart
 
NBP157341
View Documents
Novus Biologicals
NBP157341
100 μL
Each for $436.00
Add to cart
 
Description

Description

DDX25 Polyclonal specifically detects DDX25 in Human samples. It is validated for Western Blot.
Specifications

Specifications

DDX25
Polyclonal
Rabbit
Stem Cell Markers
DEAD (Asp-Glu-Ala-Asp) box polypeptide 25, DEAD box protein 25, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 25, EC 3.6.1, EC 3.6.4.13, Gonadotropin-regulated testicular RNA helicase, GRTHATP-dependent RNA helicase DDX25
DDX25
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q9UHL0-2
29118
Synthetic peptides corresponding to DDX25 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 25) The peptide sequence was selected from the C terminal of DDX25. Peptide sequence TVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit