Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DDX26B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | DDX26B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18020520
|
Novus Biologicals
NBP18020520UL |
20 μL |
Each for $152.22
|
|
NBP180205
|
Novus Biologicals
NBP180205 |
100 μL |
Each for $436.00
|
|
Description
DDX26B Polyclonal specifically detects DDX26B in Human samples. It is validated for Western Blot.Specifications
| DDX26B | |
| Polyclonal | |
| Rabbit | |
| NP_872346 | |
| 203522 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26B | |
| Synthetic peptide directed towards the N terminal of human DDX26B. Peptide sequence ASTEPEQLGSVPTDESAITQMCEVTGGRSYCVRTQRMLNQCLESLVQKVQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title