Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DDX26B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen DDX26B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP18020520
View Documents
Novus Biologicals
NBP18020520UL
20 μL
Each for $152.22
Add to cart
 
NBP180205
View Documents
Novus Biologicals
NBP180205
100 μL
Each for $436.00
Add to cart
 
Description

Description

DDX26B Polyclonal specifically detects DDX26B in Human samples. It is validated for Western Blot.
Specifications

Specifications

DDX26B
Polyclonal
Rabbit
NP_872346
203522
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26B
Synthetic peptide directed towards the N terminal of human DDX26B. Peptide sequence ASTEPEQLGSVPTDESAITQMCEVTGGRSYCVRTQRMLNQCLESLVQKVQ.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit