Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DDX42 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen DDX42
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15733520
View Documents
Novus Biologicals
NBP15733520UL
20 μL
Each for $152.22
Add to cart
 
NBP157335
View Documents
Novus Biologicals
NBP157335
100 μL
Each for $436.00
Add to cart
 
Description

Description

DDX42 Polyclonal specifically detects DDX42 in Human samples. It is validated for Western Blot.
Specifications

Specifications

DDX42
Polyclonal
Rabbit
Q86XP3
11325
Synthetic peptides corresponding to DDX42 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 42) The peptide sequence was selected from the N terminal of DDX42 (NP_031398). Peptide sequence PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
DEAD (Asp-Glu-Ala-Asp) box polypeptide 42, DEAD box protein 42, EC 3.6.1, EC 3.6.4.13, RHELPSF3b DEAD box protein, RNA helicase-like protein, RNA helicase-related protein, RNAHPFLJ43179, SF3b125 DEAD-box protein, SF3b125ATP-dependent RNA helicase DDX42, Splicing factor 3B-associated 125 kDa protein
DDX42
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit