Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DDX42 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | DDX42 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15733520
|
Novus Biologicals
NBP15733520UL |
20 μL |
Each for $152.22
|
|
NBP157335
|
Novus Biologicals
NBP157335 |
100 μL |
Each for $436.00
|
|
Description
DDX42 Polyclonal specifically detects DDX42 in Human samples. It is validated for Western Blot.Specifications
| DDX42 | |
| Polyclonal | |
| Rabbit | |
| Q86XP3 | |
| 11325 | |
| Synthetic peptides corresponding to DDX42 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 42) The peptide sequence was selected from the N terminal of DDX42 (NP_031398). Peptide sequence PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DEAD (Asp-Glu-Ala-Asp) box polypeptide 42, DEAD box protein 42, EC 3.6.1, EC 3.6.4.13, RHELPSF3b DEAD box protein, RNA helicase-like protein, RNA helicase-related protein, RNAHPFLJ43179, SF3b125 DEAD-box protein, SF3b125ATP-dependent RNA helicase DDX42, Splicing factor 3B-associated 125 kDa protein | |
| DDX42 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title