Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DDX52 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310805100UL
Description
DDX52 Polyclonal specifically detects DDX52 in Human samples. It is validated for Western Blot.Specifications
DDX52 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
ATP-dependent RNA helicase ROK1-like, DEAD (Asp-Glu-Ala-Asp) box polypeptide 52, DEAD box protein 52, EC 3.6.1, HUSSY19, probable ATP-dependent RNA helicase DDX52, ROK1EC 3.6.4.13 | |
The immunogen is a synthetic peptide directed towards the N terminal region of human DDX52 (NP_008941.2). Peptide sequence SSEVLQGLDFFGNKKSVPGVCGASQTHQKPQNGEKKEESLTERKREQSKK | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
11056 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction