DDX54 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257821

Catalog No. NBP257821

Description

DDX54 Polyclonal specifically detects DDX54 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: DDX54
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: APR-5, ATP-dependent RNA helicase DP97, DEAD (Asp-Glu-Ala-Asp) box polypeptide 54, DEAD box helicase 97 KDa, DEAD box protein 54, DEAD box RNA helicase 97 kDa, DP97ATP-dependent RNA helicase DDX54, EC 3.6.1, EC 3.6.4.13, MGC2835
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: DDX54
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TAYSLVAPDEIPYLLDLHLFLGRSLTLARPLKEPSGVAGVDGMLGRVPQSVVDEEDSGLQSTLEASLELRGLARVADNAQQQYV
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 79039
• Target Species: Human
• Isotype: IgG

For Research Use Only