Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Dectin-2/CLEC6A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen Dectin-2/CLEC6A
Immunogen Synthetic peptides corresponding to CLEC6A(C-type lectin domain family 6, member A) Antibody(against the N terminal of CLEC6A (NP_001007034). Peptide sequence FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWK.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15973920 View Documents Novus BiologicalsSupplier Diversity Partner
NBP15973920UL
20ul Each for $149.00
Add to cart
 
NBP159739 View Documents Novus BiologicalsSupplier Diversity Partner
NBP159739
100 ul Each for $329.00
Add to cart
 
Description

Description

Dectin-2/CLEC6A Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

Dectin-2/CLEC6A
Rabbit
Polyclonal
Unconjugated
93978
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to CLEC6A(C-type lectin domain family 6, member A) Antibody(against the N terminal of CLEC6A (NP_001007034). Peptide sequence FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWK.
Primary
IgG
CLEC4N, CLECSF10, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 10, C-type lectin domain family 6 member A, C-type lectin domain family 6, member A, C-type lectin superfamily member 10, DC-associated C-type lectin 2, dectin 2, Dectin-2, DECTIN2, Dendritic cell-associated C-type lectin 2
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit