Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DEGS2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310844100UL
Description
DEGS2 Polyclonal specifically detects DEGS2 in Mouse samples. It is validated for Western Blot.Specifications
DEGS2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
C14orf66, chromosome 14 open reading frame 66, Degenerative spermatocyte homolog 2, degenerative spermatocyte homolog 2, lipid desaturase (Drosophila), DES2sphingolipid delta(4)-desaturase/C4-hydroxylase DES2, EC 1.14, FADS8, sphingolipid C4-hydroxylase/delta 4-desaturase, sphingolipid delta 4 desaturase/C-4 hydroxylase | |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse DEGS2 (NP_001164473.1). Peptide sequence TFNVGYHMEHHDFPSIPGYYLPLVRKIAPEYYDHLPQHHSWVKVLWDFVF | |
100 μg | |
Lipid and Metabolism | |
123099 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Mouse | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction