Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DENND2C Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17953020UL

 View more versions of this product

Catalog No. NBP17953020


Add to cart

Description

Description

DENND2C Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

DENND2C
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
DENND2C
Synthetic peptide directed towards the middle region of human DENND2CThe immunogen for this antibody is DENND2C. Peptide sequence DIFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQL.
Immunogen affinity purified
RUO
Primary
163259
Western Blot
Western Blot 1:1000
NP_940861
DENN domain-containing protein 2C, DENN/MADD domain containing 2C, DKFZp686N1631
Rabbit
IgG
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit