Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Deoxycytidylate deaminase Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Deoxycytidylate deaminase |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157825
|
Novus Biologicals
NBP157825 |
100 μL |
Each for $436.00
|
|
NBP15782520
|
Novus Biologicals
NBP15782520UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
Deoxycytidylate deaminase Polyclonal specifically detects Deoxycytidylate deaminase in Human samples. It is validated for Western Blot.Specifications
| Deoxycytidylate deaminase | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| D3DP49 | |
| 1635 | |
| Synthetic peptides corresponding to DCTD(dCMP deaminase) The peptide sequence was selected from the middle region of DCTD. Peptide sequence MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| dCMP deaminaseEC 3.5.4.12, deoxycytidylate deaminase, MGC111062 | |
| DCTD | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title