Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DERP6 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | DERP6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157705
|
Novus Biologicals
NBP157705 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
DERP6 Polyclonal specifically detects DERP6 in Human samples. It is validated for Western Blot.Specifications
| DERP6 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8TE02 | |
| 23587 | |
| Synthetic peptides corresponding to C17ORF81 The peptide sequence was selected from the C terminal of C17ORF81. Peptide sequence FSILPDFSLDLQEGPSVESQPYSDPHIPPVSKNAKARTRKCSLVSGHGRE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| chromosome 17 open reading frame 81, dermal papilla derived protein 6, dermal papilla-derived protein 6, DERP6, MST071, MSTP071, S-phase 2 protein | |
| ELP5 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title