Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DERP6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen DERP6
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157705
View Documents
Novus Biologicals
NBP157705
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

DERP6 Polyclonal specifically detects DERP6 in Human samples. It is validated for Western Blot.
Specifications

Specifications

DERP6
Polyclonal
Rabbit
Human
Q8TE02
23587
Synthetic peptides corresponding to C17ORF81 The peptide sequence was selected from the C terminal of C17ORF81. Peptide sequence FSILPDFSLDLQEGPSVESQPYSDPHIPPVSKNAKARTRKCSLVSGHGRE.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
chromosome 17 open reading frame 81, dermal papilla derived protein 6, dermal papilla-derived protein 6, DERP6, MST071, MSTP071, S-phase 2 protein
ELP5
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit