Desmocollin-3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159227

Catalog No. NBP159227

Description

Desmocollin-3 Polyclonal specifically detects Desmocollin-3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Desmocollin-3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q14574
• Gene Symbols: DSC3
• Immunogen: Synthetic peptides corresponding to DSC3(desmocollin 3) The peptide sequence was selected from the N terminal of DSC3. Peptide sequence MQENSLGPFPLFLQQVESDAAQNYTVFYSISGRGVDKEPLNLFYIERDTG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Canine: 92%; Rat: 92%; Mouse: 85%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cadherin family member 3, CDHF3HT-CP, desmocollin 3, desmocollin-4, DSC, DSC1, DSC2, DSC4desmocollin-3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1825
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.