Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Desmocollin-3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
Antigen | Desmocollin-3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15922720
|
Novus Biologicals
NBP15922720UL |
20 μL |
Each for $204.00
|
|
|||||
NBP159227
|
Novus Biologicals
NBP159227 |
100 μL |
Each for $482.50
|
|
|||||
Description
Desmocollin-3 Polyclonal specifically detects Desmocollin-3 in Human samples. It is validated for Western Blot.Specifications
Desmocollin-3 | |
Polyclonal | |
Rabbit | |
Q14574 | |
1825 | |
Synthetic peptides corresponding to DSC3(desmocollin 3) The peptide sequence was selected from the N terminal of DSC3. Peptide sequence MQENSLGPFPLFLQQVESDAAQNYTVFYSISGRGVDKEPLNLFYIERDTG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Cadherin family member 3, CDHF3HT-CP, desmocollin 3, desmocollin-4, DSC, DSC1, DSC2, DSC4desmocollin-3 | |
DSC3 | |
IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title