Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DGK-epsilon Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159067
Description
DGK-epsilon Polyclonal specifically detects DGK-epsilon in Human, Mouse samples. It is validated for Western Blot.Specifications
DGK-epsilon | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DAG kinase epsilon, DAGK5, DAGK6, DGK, DGK-epsilon, diacylglycerol kinase epsilon, diacylglycerol kinase, epsilon (64kD), diacylglycerol kinase, epsilon 64kDa, Diglyceride kinase epsilon, EC 2.7.1.107 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%. | |
Human, Mouse, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
P52429 | |
DGKE | |
Synthetic peptides corresponding to DGKE(diacylglycerol kinase, epsilon 64kDa) The peptide sequence was selected from the N terminal of DGKE. Peptide sequence EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR. | |
100 μL | |
Lipid and Metabolism | |
8526 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction