Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DHODH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15958420UL
Description
DHODH Polyclonal specifically detects DHODH in Human samples. It is validated for Western Blot.Specifications
DHODH | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q02127 | |
DHODH | |
Synthetic peptides corresponding to DHODH(dihydroorotate dehydrogenase) The peptide sequence was selected from the N terminal of DHODH. Peptide sequence GEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNS. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
DHOdehase, dihydroorotate dehydrogenase, dihydroorotate dehydrogenase, mitochondrial, Dihydroorotate oxidase, EC 1.3.3.1, EC 1.3.5.2, human complement of yeast URA1, POADS, URA1 | |
Rabbit | |
Affinity Purified | |
RUO | |
1723 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction