Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DHRS3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | DHRS3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179192
|
Novus Biologicals
NBP179192 |
100 μL |
Each of 1 for $436.00
|
|
Description
DHRS3 Polyclonal specifically detects DHRS3 in Mouse samples. It is validated for Western Blot.Specifications
DHRS3 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DD83.1, dehydrogenase/reductase (SDR family) member 3, EC 1.1.1, EC 1.1.1.300, RDH17, Retinal short-chain dehydrogenase/reductase 1, RETSDR1, retSDR1short chain dehydrogenase/reductase family 16C, member 1, Rsdr1, SDR1, SDR16C1, short-chain dehydrogenase/reductase 1, short-chain dehydrogenase/reductase 3 | |
DHRS3 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
NP_035433 | |
9249 | |
The immunogen for this antibody is Dhrs3. Peptide sequence PGVSATTVLPFHTSTEMFQGMRVRFPNLFPPLKPETVARRTVDAVQQNQA. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title