DHRSX Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179978

Catalog No. NBP179978

Description

DHRSX Polyclonal specifically detects DHRSX in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DHRSX
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_660160
• Gene Symbols: DHRSX
• Immunogen: Synthetic peptide directed towards the C terminal of human DHRSX. Peptide sequence DEGAWTSIYAAVTPELEGVGGHYLYNEKETKSLHVTYNQKLQQQLWSKSC.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Rat: 79%.
• Target Species: Human, Rat, Canine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: CXorf11, dehydrogenase/reductase (SDR family) X chromosome, dehydrogenase/reductase (SDR family) X-linked, DHRS5Xmember 1, EC 1.1, SDR46C1
• Host Species: Rabbit
• Molecular Weight of Antigen: 36 kDa
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 207063
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.