Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DHX15 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen DHX15
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157204
View Documents
Novus Biologicals
NBP157204
100 μL
Each for $436.00
Add to cart
 
NBP15720420
View Documents
Novus Biologicals
NBP15720420UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

DHX15 Polyclonal specifically detects DHX15 in Human samples. It is validated for Western Blot.
Specifications

Specifications

DHX15
Polyclonal
Rabbit
O43143
1665
Synthetic peptides corresponding to DHX15(DEAH (Asp-Glu-Ala-His) box polypeptide 15) The peptide sequence was selected from the C terminal of DHX15. Peptide sequence YINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVL.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
ATP-dependent RNA helicase #46, DBP1DEAH box protein 15, DDX15putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 15, DEAH (Asp-Glu-Ala-His) box polypeptide 15, EC 3.6.1, EC 3.6.4.13, HRH2DEAD/H box-15, PRP43, PRPF43, PrPp43p, RNA helicase 2
DHX15
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit