Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DHX35 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

$152.22 - $436.00

Specifications

Antigen DHX35
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15734820
View Documents
Novus Biologicals
NBP15734820UL
20 μL
Each for $152.22
Add to cart
 
NBP157348
View Documents
Novus Biologicals
NBP157348
100 μL
Each for $436.00
Add to cart
 
Description

Description

DHX35 Polyclonal specifically detects DHX35 in Human samples. It is validated for Western Blot.
Specifications

Specifications

DHX35
Polyclonal
Rabbit
Q9H5Z1
60625
Synthetic peptides corresponding to DHX35(DEAH (Asp-Glu-Ala-His) box polypeptide 35) The peptide sequence was selected from the N terminal of DHX35. Peptide sequence MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
C20orf15, DDX35, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 35, DEAH (Asp-Glu-Ala-His) box polypeptide 35, DEAH box protein 35, DEAH-box protein 35, EC 3.6.1, EC 3.6.4.13, FLJ22759, KAIA0875, probable ATP-dependent RNA helicase DHX35
DHX35
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit