DIABLO Rabbit anti-Human, Rat, Polyclonal , Abnova™

Rabbit polyclonal antibody raised against recombinant human DIABLO.

Supplier:  Abnova Corporation PAB29316

Catalog No. 89-934-044

Description

This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and it moderates the caspase inhibition of IAPs. Multiple polyadenylation sites have been found for this gene. Four alternatively spliced transcript variants have been described for this gene, with two of them encoding different isoforms and the other two probably not encoding a protein. [provided by RefSeq]

Sequence: AVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEG

Specifications

• Antigen: DIABLO
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant human DIABLO.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Symbols: DIABLO
• Immunogen: Recombinant protein corresponding to amino acids of human DIABLO.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Form: Liquid

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:20-1:50) Western Blot (1:100-1:250) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Gene Alias: DIABLO-S/FLJ10537/FLJ25049/SMAC/SMAC3
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 56616
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG