Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DIP2A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | DIP2A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15690920
|
Novus Biologicals
NBP15690920UL |
20 μL |
Each for $152.22
|
|
NBP156909
|
Novus Biologicals
NBP156909 |
100 μL |
Each for $436.00
|
|
Description
DIP2A Polyclonal specifically detects DIP2A in Human samples. It is validated for Western Blot.Specifications
| DIP2A | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Dip2, DIP2 disco-interacting protein 2 homolog A (Drosophila), DIP2 homolog A, DIP2C21orf106, disco-interacting protein 2 homolog A, disco-interacting protein 2A, KIAA0184chromosome 21 open reading frame 106 | |
| DIP2A | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q14689 | |
| 23181 | |
| Synthetic peptides corresponding to DIP2A(DIP2 disco-interacting protein 2 homolog A (Drosophila)) The peptide sequence was selected from the N terminal of DIP2A. Peptide sequence PLKEFFVDDFEELLEVQQPDPNQPKPEGSETSVLRGEPLTAGVPRPPSLL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title