Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DIRAS1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | DIRAS1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15893520
|
Novus Biologicals
NBP15893520UL |
20 μL |
Each for $152.22
|
|
NBP158935
|
Novus Biologicals
NBP158935 |
100 μL |
Each for $436.00
|
|
Description
DIRAS1 Polyclonal specifically detects DIRAS1 in Human samples. It is validated for Western Blot.Specifications
| DIRAS1 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| O95057 | |
| 148252 | |
| Synthetic peptides corresponding to DIRAS1(DIRAS family, GTP-binding RAS-like 1) The peptide sequence was selected from the middle region of DIRAS1. Peptide sequence KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DIRAS family, GTP-binding RAS-like 1, Di-Ras1, Distinct subgroup of the Ras family member 1, GBTS1Small GTP-binding tumor suppressor 1, GTP-binding protein Di-Ras1, Ras-related inhibitor of cell growth, Rig, RIGFLJ42681 | |
| DIRAS1 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title