Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DIRAS1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen DIRAS1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15893520
View Documents
Novus Biologicals
NBP15893520UL
20 μL
Each for $152.22
Add to cart
 
NBP158935
View Documents
Novus Biologicals
NBP158935
100 μL
Each for $436.00
Add to cart
 
Description

Description

DIRAS1 Polyclonal specifically detects DIRAS1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

DIRAS1
Polyclonal
Rabbit
Signal Transduction
O95057
148252
Synthetic peptides corresponding to DIRAS1(DIRAS family, GTP-binding RAS-like 1) The peptide sequence was selected from the middle region of DIRAS1. Peptide sequence KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVK.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
DIRAS family, GTP-binding RAS-like 1, Di-Ras1, Distinct subgroup of the Ras family member 1, GBTS1Small GTP-binding tumor suppressor 1, GTP-binding protein Di-Ras1, Ras-related inhibitor of cell growth, Rig, RIGFLJ42681
DIRAS1
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit